{"product_id":"proteintech-24899-1-ap","title":"Proteintech, 24899-1-AP, LRP5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LRP5 (24899-1-AP) by Proteintech is a Polyclonal antibody targeting LRP5 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n24899-1-AP targets LRP5 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: mouse lung tissue, human hepatocirrhosis tissue,  human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLow-density lipoprotein receptor-related protein 5 (LRP5) is a single-pass type I membrane protein with EGF-like and LDLR domains in the extracellular domain. LRP5 and LRP6 act as coreceptors with Frizzled for Wnt. The complex of Wnt-Fzd-LRP5-LRP6 triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes. LRP5 plays a key role in skeletal homeostasis and many bone density related diseases are caused by mutations in LRP5 gene.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19034 Product name: Recombinant human LRP5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1332-1397 aa of BC150595 Sequence: CDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSL Predict reactive species\nFull Name: low density lipoprotein receptor-related protein 5\nCalculated Molecular Weight: 1615 aa, 179 kDa\nObserved Molecular Weight: 180-200 kDa\nGenBank Accession Number: BC150595\nGene Symbol: LRP5\nGene ID (NCBI): 4041\nRRID: AB_2879786\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75197\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868906934441,"sku":"24899-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24899-1-ap","provider":"Iright","version":"1.0","type":"link"}