{"product_id":"proteintech-24901-1-ap","title":"Proteintech, 24901-1-AP, SLC22A23 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC22A23 (24901-1-AP) by Proteintech is a Polyclonal antibody targeting SLC22A23 in WB, IP, IHC, ELISA applications with reactivity to human,  mouse,  rat samples\n24901-1-AP targets SLC22A23 in WB, IP, IHC, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells,  mouse kidney tissue,  mouse liver tissue,  rat liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19036 Product name: Recombinant human SLC22A23 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 84-186 aa of BC128580 Sequence: ESLRWLMATQQFESAKRLILHFTQKNRMNPEGDIKGVIPELEKELSRRPKKVCIVKVVGTRNLWKNIVVLCVNSLTGYGIHHCFARSMMGHEVKVPLLENFYA Predict reactive species\nFull Name: solute carrier family 22, member 23\nCalculated Molecular Weight: 686 aa, 74 kDa\nObserved Molecular Weight: 66-74 kDa\nGenBank Accession Number: BC128580\nGene Symbol: SLC22A23\nGene ID (NCBI): 63027\nRRID: AB_2879787\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: A1A5C7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887804272809,"sku":"24901-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24901-1-ap","provider":"Iright","version":"1.0","type":"link"}