{"product_id":"proteintech-24903-1-ap","title":"Proteintech, 24903-1-AP, SOX17 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SOX17 (24903-1-AP) by Proteintech is a Polyclonal antibody targeting SOX17 in WB, ELISA applications with reactivity to human, mouse, rat samples\n24903-1-AP targets SOX17 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C6 cells, PC-3 cells,  mouse embryo\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTranscription factor SOX 17 (SOX17) also named as SRY box 17 is a 414 amino acid protein, which contains one Sox C-terminal domain and one HMG box DNA-binding domain. SOX17 as a transcription regulator binds target promoter DNA and bend the DNA via WNT3A. SOX17 is a marker of endodermal cells and a transcriptional regulator containing a DNA binding domain called the HMG box. In mouse embryos, SOX17 plays critical roles in the growth and differentiation of definitive endodermal cells (PMID: 11973269), the remodeling of endothelial cells (PMID: 16895970), hindgut endoderm expansion with localization of primordial germ cells (PMID: 19371732), and gallbladder\/bile duct formation (PMID: 19913509).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19157 Product name: Recombinant human SOX17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-66 aa of BC111365 Sequence: MSSPDAGYASDDQSQTQSALPAVMAGLGPCPWAESLSPIGDMKVKGEAPANSGAPAGAAGRAKGES Predict reactive species\nFull Name: SRY (sex determining region Y)-box 17\nCalculated Molecular Weight: 414 aa, 44 kDa\nObserved Molecular Weight: 44 kDa\nGenBank Accession Number: BC111365\nGene Symbol: SOX17\nGene ID (NCBI): 64321\nRRID: AB_2879789\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H6I2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868875280553,"sku":"24903-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24903-1-ap","provider":"Iright","version":"1.0","type":"link"}