{"product_id":"proteintech-24918-1-ap","title":"Proteintech, 24918-1-AP, ST8SIA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ST8SIA1 (24918-1-AP) by Proteintech is a Polyclonal antibody targeting ST8SIA1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n24918-1-AP targets ST8SIA1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, A375 cells,  MCF-7 cells,  MDA-MB-231 cells,  SH-SY5Y cells,  SK-N-SH cells\nPositive IHC detected in: human paracancerous of skin cancer, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nST8SIA1 is a member of the ST family involved in the production of gangliosides. ST8SIA1 is strongly expressed in melanoma cell lines, adult and fetal brain, and to a lesser extent in adult and fetal lung. The abnormal expression of ST8SIA1 has been demonstrated to influence the metastasis of triple-negative breast cancer. (PMID: 34429775)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20429 Product name: Recombinant human ST8SIA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 39-136 aa of BC126162 Sequence: VLCWLYIFPVYRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLK Predict reactive species\nFull Name: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1\nCalculated Molecular Weight: 356 aa, 41 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC126162\nGene Symbol: ST8SIA1\nGene ID (NCBI): 6489\nRRID: AB_2879796\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92185\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868930429097,"sku":"24918-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24918-1-ap","provider":"Iright","version":"1.0","type":"link"}