{"product_id":"proteintech-24940-1-ap","title":"Proteintech, 24940-1-AP, RPL39L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RPL39L (24940-1-AP) by Proteintech is a Polyclonal antibody targeting RPL39L in WB, IHC, ELISA applications with reactivity to human samples\n24940-1-AP targets RPL39L in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20923 Product name: Recombinant human RPL39L protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-51 aa of BC012328 Sequence: MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL Predict reactive species\nFull Name: ribosomal protein L39-like\nCalculated Molecular Weight: 51 aa, 6 kDa\nObserved Molecular Weight: 6 kDa\nGenBank Accession Number: BC012328\nGene Symbol: RPL39L\nGene ID (NCBI): 116832\nRRID: AB_2879810\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96EH5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887788314793,"sku":"24940-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24940-1-ap","provider":"Iright","version":"1.0","type":"link"}