{"product_id":"proteintech-24986-1-ap","title":"Proteintech, 24986-1-AP, AKAP4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AKAP4 (24986-1-AP) by Proteintech is a Polyclonal antibody targeting AKAP4 in WB, IHC, ELISA applications with reactivity to human samples\n24986-1-AP targets AKAP4 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAKAP4, also named as A-kinase anchor protein 82 kDa, is a 854 amino acid protein, which belongs to the AKAP110 family. AKAP4 localizes to the principle piece of the sperm flagellum and is only expressed in round spermatids. AKAP4 is a major structural component of sperm fibrous sheath and plays a role in sperm motility.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21762 Product name: Recombinant human AKAP4 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 565-693 aa of BC126252 Sequence: TCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQAN Predict reactive species\nFull Name: A kinase (PRKA) anchor protein 4\nCalculated Molecular Weight: 854 aa, 94 kDa\nObserved Molecular Weight: 82 kDa\nGenBank Accession Number: BC126252\nGene Symbol: AKAP4\nGene ID (NCBI): 8852\nRRID: AB_2876859\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5JQC9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868976042153,"sku":"24986-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24986-1-ap","provider":"Iright","version":"1.0","type":"link"}