{"product_id":"proteintech-24989-1-ap","title":"Proteintech, 24989-1-AP, KHDC3L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KHDC3L (24989-1-AP) by Proteintech is a Polyclonal antibody targeting KHDC3L in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n24989-1-AP targets KHDC3L in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue\nPositive IHC detected in: human colon cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKHDC3L (also known as Filia and ES cell-associated transcript1 [Ecat1]) as a key regulator in safeguarding the genomic stability of mouse early embryonic cells. KHDC3L is critical in preventing the replication associated DNA DSBs in epiblast cells (PMID: 29125140). Importantly, by analyzing KHDC3L mutations causes recurrent pregnancy loss by inducing genomic instability of human early embryonic cells (PMID: 31609975).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21790 Product name: Recombinant human C6orf221 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-217 aa of BC137160 Sequence: MDAPRRFPTLVQLMQPKAMPVEVLGHLPKRFSWFHSEFLKNPKVVRLEVWLVEKIFGRGGERIPHVQGMSQILIHVNRLDPNGEAEILVFGRPSYQEDTIKMIMNLADYHRQLQAKGSGKALAQDVATQKAETQRSSIEVREAGTQRSVEVREAGTQRSVEVQEVGTQGSPVEVQEAGTQQSLQAANKSGTQRSPEAASKAVTQRFREDARDPVTRL Predict reactive species\nFull Name: chromosome 6 open reading frame 221\nCalculated Molecular Weight: 217 aa, 24 kDa\nObserved Molecular Weight: 21-24 kDa\nGenBank Accession Number: BC137160\nGene Symbol: KHDC3L\nGene ID (NCBI): 154288\nRRID: AB_2879833\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q587J8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887694270633,"sku":"24989-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24989-1-ap","provider":"Iright","version":"1.0","type":"link"}