{"product_id":"proteintech-25014-1-ap","title":"Proteintech, 25014-1-AP, hCG Alpha Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe hCG Alpha (25014-1-AP) by Proteintech is a Polyclonal antibody targeting hCG Alpha in WB, IHC, ELISA applications with reactivity to human samples\n25014-1-AP targets hCG Alpha in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: JAR cells, human placenta tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17313 Product name: Recombinant human CGA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-116 aa of BC020782 Sequence: SAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS Predict reactive species\nFull Name: glycoprotein hormones, alpha polypeptide\nCalculated Molecular Weight: 116 aa, 13 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC020782\nGene Symbol: hCG Alpha\nGene ID (NCBI): 1081\nRRID: AB_2879846\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01215\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868999209129,"sku":"25014-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25014-1-ap","provider":"Iright","version":"1.0","type":"link"}