{"product_id":"proteintech-25035-1-ap","title":"Proteintech, 25035-1-AP, CDNF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDNF (25035-1-AP) by Proteintech is a Polyclonal antibody targeting CDNF in WB, IHC, ELISA applications with reactivity to human, mouse samples\n25035-1-AP targets CDNF in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18972 Product name: Recombinant human ARMETL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 103-187 aa of BC133042 Sequence: MSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL Predict reactive species\nFull Name: arginine-rich, mutated in early stage tumors-like 1\nCalculated Molecular Weight: 187 aa, 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC133042\nGene Symbol: ARMETL1\nGene ID (NCBI): 441549\nRRID: AB_2879861\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q49AH0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886409994409,"sku":"25035-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25035-1-ap","provider":"Iright","version":"1.0","type":"link"}