{"product_id":"proteintech-25044-1-ap","title":"Proteintech, 25044-1-AP, HOXA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HOXA2 (25044-1-AP) by Proteintech is a Polyclonal antibody targeting HOXA2 in WB, ELISA applications with reactivity to human,  rat samples\n25044-1-AP targets HOXA2 in WB, ELISA applications and shows reactivity with human,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  C6 cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHOXA2, also named as Homeobox protein Hox-A2, is a 376 amino acid protein, which contains 1 homeobox DNA-binding domain and belongs to the Antp homeobox family. HOXA2 localizes in the nucleus and hsa an association with Microtia, hearing impairment, and cleft palate. HOXA2 as a sequence-specific transcription factor is part of a developmental regulatory system, which  provides cells with specific positional identities on the anterior-posterior axis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19224 Product name: Recombinant human HOXA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 256-340 aa of BC130571 Sequence: LSQQQAPNGHNGDSQSFPVSPLTSNEKNLKHFQHQSPTVPNCLSTMGQNCGAGLNNDSPEALEVPSLQDFSVFSTDSCLQLSDAV Predict reactive species\nFull Name: homeobox A2\nCalculated Molecular Weight: 376 aa, 41 kDa\nObserved Molecular Weight: 41-43 kDa\nGenBank Accession Number: BC130571\nGene Symbol: HOXA2\nGene ID (NCBI): 3199\nRRID: AB_2879868\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43364\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869694677161,"sku":"25044-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25044-1-ap","provider":"Iright","version":"1.0","type":"link"}