{"product_id":"proteintech-25048-1-ap","title":"Proteintech, 25048-1-AP, ZFAND5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZFAND5 (25048-1-AP) by Proteintech is a Polyclonal antibody targeting ZFAND5 in WB, ELISA applications with reactivity to human, mouse, rat samples\n25048-1-AP targets ZFAND5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZFAND5 is Involved in protein degradation via the ubiquitin-proteasome system and may act by anchoring ubiquitinated proteins to the proteasome. It plays a role in ubiquitin-mediated protein degradation during muscle atrophy and in the regulation of NF-kappa-B activation and apoptosis. It can inhibit NF-kappa-B activation triggered by overexpression of RIPK1 and TRAF6 but not of RELA. It also inhibits tumor necrosis factor (TNF), IL-1, and TLR4-induced NF-kappa-B activation in a dose-dependent manner.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19311 Product name: Recombinant human ZFAND5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 75-141 aa of BC027707 Sequence: NCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSEE Predict reactive species\nFull Name: zinc finger, AN1-type domain 5\nCalculated Molecular Weight: 213 aa, 23 kDa\nObserved Molecular Weight: 23-35 kDa\nGenBank Accession Number: BC027707\nGene Symbol: ZFAND5\nGene ID (NCBI): 7763\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O76080\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887928201385,"sku":"25048-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25048-1-ap","provider":"Iright","version":"1.0","type":"link"}