{"product_id":"proteintech-25090-1-ap","title":"Proteintech, 25090-1-AP, PCDH9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PCDH9 (25090-1-AP) by Proteintech is a Polyclonal antibody targeting PCDH9 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n25090-1-AP targets PCDH9 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human gliomas tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtocadherin-9 (PCDH9) is a member of the protocadherin family that belongs to the cadherin superfamily. Protocadherins are calcium-dependent adhesion proteins and have been implicated in neural cell-cell interactions. They are abundantly expressed in the central nervous system during embryonic development and in adulthood (PMID: 24214103). PCDH9 is a single-pass type I membrane protein that contains seven cadherin motifs in its extracellular domain. It might be involved in the formation of specific neural circuits during neural development (PMID: 22982106).What is the molecular weight of PCDH9?The calculated molecular weight of PCDH9 is 136 kDa.What are the isoforms of PCDH9?Alternatively spliced transcript variants encoding distinct isoforms have been identified for the PCDH9 gene; a short transcript, a standard transcript, a transcript with additional exon 2, and another transcript with variant exon 3 (PMID: 15095963).What is PCDH9's involvement in neural development?The family of protocadherins is essential for neural development as mutations in these proteins give rise to neurodevelopmental disorders such as schizophrenia and epilepsy. However, the exact mechanisms of loss of function and the role of PCDH9 remain to be fully characterized (PMID: 22982106).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18696 Product name: Recombinant human PCDH9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1146-1237 aa of BC136626 Sequence: PGLGPYQHPKSPLSTFAPQKEWVKKDKLVNGHTLTRAWKEDSNRNQFNDRKQYGSNEGHFNNGSHMTDIPLANLKSYKQAGGATESPKEHQL Predict reactive species\nFull Name: protocadherin 9\nCalculated Molecular Weight: 1237 aa, 136 kDa\nObserved Molecular Weight: 150-180 kDa\nGenBank Accession Number: BC136626\nGene Symbol: PCDH9\nGene ID (NCBI): 5101\nRRID: AB_2879891\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HC56\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868971585705,"sku":"25090-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25090-1-ap","provider":"Iright","version":"1.0","type":"link"}