{"product_id":"proteintech-25091-1-ap","title":"Proteintech, 25091-1-AP, TMEM87A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM87A (25091-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM87A in WB, IHC, ELISA applications with reactivity to human, mouse samples\n25091-1-AP targets TMEM87A in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells, MDA-MB-453s cells,  PC-3 cells\nPositive IHC detected in: human breast cancer tissue,  human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18715 Product name: Recombinant human TMEM87A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 71-160 aa of BC005335 Sequence: GEPCDLSLNITWYLKSADCYNEIYNFKAEEVELYLEKLKEKRGLSGKYQTSSKLFQNCSELFKTQTFSGDFMHRLPLLGEKQEAKENGTN Predict reactive species\nFull Name: transmembrane protein 87A\nCalculated Molecular Weight: 555 aa, 63 kDa\nObserved Molecular Weight: 63-70 kDa\nGenBank Accession Number: BC005335\nGene Symbol: TMEM87A\nGene ID (NCBI): 25963\nRRID: AB_2879892\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NBN3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887833698473,"sku":"25091-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25091-1-ap","provider":"Iright","version":"1.0","type":"link"}