{"product_id":"proteintech-25102-1-ap","title":"Proteintech, 25102-1-AP, NMES1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NMES1 (25102-1-AP) by Proteintech is a Polyclonal antibody targeting NMES1 in WB, ELISA applications with reactivity to human, mouse samples\n25102-1-AP targets NMES1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue, mouse colon tissue,  mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNmes1, encoding for Normal Mucosa of Esophagus-Specific gene 1, also known as C15orf48, Modulator of Cytochrome C Oxidase during Inflammation [MOCCI]), was first identified in a study of human esophageal squamous cell carcinoma (ESCC) tissues (PMID: 30013631). Nmes1 is expressed in epithelial tissue and is believed to be a tumor suppressor gene. Nmes1 encodes for a small protein consisting of 83 amino acid and is a nuclear protein (PMID: 37971166).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18744 Product name: Recombinant human C15orf48 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-83 aa of BC021173 Sequence: FFQLLMKRKELIPLVVFMTVAAGGASSFAVYSLWKTDVILDRKKNPEPWETVDPTVPQKLITINQQWKPIEELQNVQRVTK Predict reactive species\nFull Name: chromosome 15 open reading frame 48\nCalculated Molecular Weight: 83 aa, 9 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC021173\nGene Symbol: C15orf48\nGene ID (NCBI): 84419\nRRID: AB_3669463\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9C002\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887739326633,"sku":"25102-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25102-1-ap","provider":"Iright","version":"1.0","type":"link"}