{"product_id":"proteintech-25118-1-ap","title":"Proteintech, 25118-1-AP, DNAJB13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DNAJB13 (25118-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJB13 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, canine samples\n25118-1-AP targets DNAJB13 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, canine samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis\nPositive IHC detected in: mouse testis tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, canine\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18934 Product name: Recombinant human DNAJB13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 204-316 aa of BC153176 Sequence: PNIIPADIIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGEGMPLPEDPTKKGDLFIFFDIQFPTRLTPQKKQMLRQALLT Predict reactive species\nFull Name: DnaJ (Hsp40) related, subfamily B, member 13\nCalculated Molecular Weight: 316 aa, 36 kDa\nObserved Molecular Weight: 32-36 kDa\nGenBank Accession Number: BC153176\nGene Symbol: DNAJB13\nGene ID (NCBI): 374407\nRRID: AB_2879906\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P59910\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869456912553,"sku":"25118-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25118-1-ap","provider":"Iright","version":"1.0","type":"link"}