{"product_id":"proteintech-25120-1-ap","title":"Proteintech, 25120-1-AP, TPTE2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TPTE2 (25120-1-AP) by Proteintech is a Polyclonal antibody targeting TPTE2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n25120-1-AP targets TPTE2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19169 Product name: Recombinant human TPTE2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-62 aa of BC128146 Sequence: MNESPQTNEFKGTTEEAPAKESPHTSEFKGAALVSPISKSMLERLSKFEVEDAENVASYEWT Predict reactive species\nFull Name: transmembrane phosphoinositide 3-phosphatase and tensin homolog 2\nCalculated Molecular Weight: 522 aa, 61 kDa\nObserved Molecular Weight: 38-60 kDa\nGenBank Accession Number: BC128146\nGene Symbol: TPTE2\nGene ID (NCBI): 93492\nRRID: AB_2879908\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6XPS3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887836647593,"sku":"25120-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25120-1-ap","provider":"Iright","version":"1.0","type":"link"}