{"product_id":"proteintech-25131-1-ap","title":"Proteintech, 25131-1-AP, AQP7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AQP7 (25131-1-AP) by Proteintech is a Polyclonal antibody targeting AQP7 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n25131-1-AP targets AQP7 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, mouse testis tissue\nPositive IP detected in: mouse kidney tissue\nPositive IHC detected in: human kidney tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAQP7 is a member of the aquaporin family of water-selective membrane channels, localizes to the plasma membrane, and allows movement of water, glycerol and urea across cell membranes. AQP7 forms a channel that mediates water and glycerol transport across cell membranes at neutral pH. AQP7 is highly expressed in the adipose tissue(PMID: 9405233).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse, sheep\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17945 Product name: Recombinant human AQP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 68-122 aa of BC062701 Sequence: LAAATIYSLFYTAILHFSGGQLMVTGPVATAGIFATYLPDHMTLWRGFLNEAWLT Predict reactive species\nFull Name: aquaporin 7\nCalculated Molecular Weight: 342 aa, 37 kDa\nObserved Molecular Weight: 25-30 kDa, 40 kDa\nGenBank Accession Number: BC062701\nGene Symbol: AQP7\nGene ID (NCBI): 364\nRRID: AB_2879913\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14520\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869393113257,"sku":"25131-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25131-1-ap","provider":"Iright","version":"1.0","type":"link"}