{"product_id":"proteintech-25132-1-ap","title":"Proteintech, 25132-1-AP, RNF38 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNF38 (25132-1-AP) by Proteintech is a Polyclonal antibody targeting RNF38 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n25132-1-AP targets RNF38 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells\nPositive IHC detected in: human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRING finger protein 38 is a protein that in humans is encoded by the RNF38 gene.This gene encodes a protein with a coiled-coil motif and a RING-H2 motif (C3H2C2) at its carboxy-terminus. The RING motif is a zinc-binding domain found in a large set of proteins playing roles in diverse cellular processes including oncogenesis, development, signal transduction, and apoptosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. RNF38 is widely expressed with highest levels in testis. RNF38 exists various isoforms and molecular weight of isoforms are 36, 48, 52 and 58 kDa\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16054 Product name: Recombinant human RNF38 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 116-465 aa of BC033786 Sequence: VSPRLLHPAAHPPQQNAVMVDIHDQLHQGTVPVSYTVTTVAPHGIPLCTGQHIPACSTQQVPGCSVVFSGQHLPVCSVPPPMLQACSVQHLPVPYAAFPPLISSDPFLIHPPHLSPHHPPHLPPPGQFVPFQTQQSRSPLQRIENEVELLGEHLPVGGFTYPPSAHPPTLPPSAPLQFLTHDPLHQEVSFGVPYPPFMPRRLTGRSRYRSQQPIPPPPYHPSLLPYVLSMLPVPPAVGPTFSFELDVEDGEVENYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADASEVHRDSE Predict reactive species\nFull Name: ring finger protein 38\nCalculated Molecular Weight: 515 aa, 58 kDa\nObserved Molecular Weight: 43-58 kDa\nGenBank Accession Number: BC033786\nGene Symbol: RNF38\nGene ID (NCBI): 152006\nRRID: AB_2879914\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H0F5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869757132969,"sku":"25132-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25132-1-ap","provider":"Iright","version":"1.0","type":"link"}