{"product_id":"proteintech-25138-1-ap","title":"Proteintech, 25138-1-AP, CCDC12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCDC12 (25138-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC12 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n25138-1-AP targets CCDC12 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  Raji cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCDC12 is a 166aa protein with MW 18-25 kDa (with some modification).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18223 Product name: Recombinant human CCDC12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC020830 Sequence: MEATTAGVGRLEEEALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIRERLKGQEDSLASAVDAATEQKTCDSD Predict reactive species\nFull Name: coiled-coil domain containing 12\nCalculated Molecular Weight: 166 aa, 19 kDa\nObserved Molecular Weight: 18-25 kDa\nGenBank Accession Number: BC020830\nGene Symbol: CCDC12\nGene ID (NCBI): 151903\nRRID: AB_2879919\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WUD4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885887148201,"sku":"25138-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25138-1-ap","provider":"Iright","version":"1.0","type":"link"}