{"product_id":"proteintech-25145-1-ap","title":"Proteintech, 25145-1-AP, SYPL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SYPL1 (25145-1-AP) by Proteintech is a Polyclonal antibody targeting SYPL1 in WB, ELISA applications with reactivity to human, mouse samples\n25145-1-AP targets SYPL1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSynaptophysin-like 1 (pantophysin, SYPL1), a neuroendocrine-related protein, is abundant in adipocytes and is found in cellular membrane compartments overlapping with those containing the insulin-sensitive glucose transporter type 4 (GLUT4) .SYLP1, which is also found in both neuronal and non-neuronal tissues, plays an important role in inflammation, tumor proliferation, and progression.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18482 Product name: Recombinant human SYPL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-92 aa of BC020938 Sequence: CGGFKGQTEIQVNCPPAVTENKTVTATFGYPFRLNEASFQPPPGVNICDVNWKDYVLIGD Predict reactive species\nFull Name: synaptophysin-like 1\nCalculated Molecular Weight: 259 aa, 29 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC020938\nGene Symbol: SYPL1\nGene ID (NCBI): 6856\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16563\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887821443241,"sku":"25145-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25145-1-ap","provider":"Iright","version":"1.0","type":"link"}