{"product_id":"proteintech-25150-1-ap","title":"Proteintech, 25150-1-AP, LIN7A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LIN7A (25150-1-AP) by Proteintech is a Polyclonal antibody targeting LIN7A in WB, IP, IHC, ELISA applications with reactivity to human,   mouse,  rat samples\n25150-1-AP targets LIN7A in WB, IP, IF, IHC, ELISA applications and shows reactivity with human,   mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18440 Product name: Recombinant human LIN7A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC118609 Sequence: MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATA Predict reactive species\nFull Name: lin-7 homolog A (C. elegans)\nCalculated Molecular Weight: 233 aa, 26 kDa\nObserved Molecular Weight: 28-30 kDa\nGenBank Accession Number: BC118609\nGene Symbol: LIN7A\nGene ID (NCBI): 8825\nRRID: AB_2879925\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14910\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869703590057,"sku":"25150-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25150-1-ap","provider":"Iright","version":"1.0","type":"link"}