{"product_id":"proteintech-25152-1-ap","title":"Proteintech, 25152-1-AP, ZNF253 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF253 (25152-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF253 in WB, ELISA applications with reactivity to human samples\n25152-1-AP targets ZNF253 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  SMMC-7721 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZNF253, also named as Zinc finger protein 411 or BMZF1, is a 499 amino acid protein, which contains one KRAB domain and eleven C2H2-type zinc fingers. ZNF253 belongs to the krueppel C2H2-type zinc-finger protein family and is expressed in bone marrow and in monocytic and immature erythroid cell lines. ZNF253 may function as a transcription factor.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18570 Product name: Recombinant human ZNF253 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 63-130 aa of BC125063 Sequence: LTMERHEMIAKPPVMSSHFAQDLWPENIQNSFQIGMLRRYEECRHDNLQLKKGCKSVGEHKVHKGGYN Predict reactive species\nFull Name: zinc finger protein 253\nCalculated Molecular Weight: 499 aa, 58 kDa\nObserved Molecular Weight: 58-65 kDa\nGenBank Accession Number: BC125063\nGene Symbol: ZNF253\nGene ID (NCBI): 56242\nRRID: AB_2879927\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75346\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887942684841,"sku":"25152-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25152-1-ap","provider":"Iright","version":"1.0","type":"link"}