{"product_id":"proteintech-25163-1-ap","title":"Proteintech, 25163-1-AP, FAM40B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM40B (25163-1-AP) by Proteintech is a Polyclonal antibody targeting FAM40B in WB, ELISA applications with reactivity to human, mouse, rat samples\n25163-1-AP targets FAM40B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM40B, also known as STRIP2, is a member of the striatin-interacting phosphatase and kinase (STRIPAK) complex that is involved in the regulation of various processes such as cell proliferation and differentiation. Fam40b in ESCs is as a perinuclear and nucleolar protein with a molecular weight of 96kDa (PMID: 25010986). The expression of Fam40b is essential for the lineage commitment of murine embryonic stem cells (mESCs) into differentiated somatic cells via mechanisms involving pluripotency and epigenetic networks. Catalog#17293-1-AP specially recognises the 96 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18230 Product name: Recombinant human FAM40B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 268-413 aa of BC019064 Sequence: KVLLLLWKVVMFTLGGFEHLQTLKVQKRAELGLPPLAEDSIQVVKSMRAASPPSYTLDLGESQLAPPPSKLRGRRGSRRQLLTKQDSLDIYNERDLFKTEEPATEEEEESAGDGERTLDGELDLLEQDPLVPPPPSQAPLSAERVA Predict reactive species\nFull Name: family with sequence similarity 40, member B\nCalculated Molecular Weight: 834 aa, 95 kDa\nObserved Molecular Weight: 95-100 kDa\nGenBank Accession Number: BC019064\nGene Symbol: FAM40B\nGene ID (NCBI): 57464\nRRID: AB_2879933\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9ULQ0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869460517033,"sku":"25163-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25163-1-ap","provider":"Iright","version":"1.0","type":"link"}