{"product_id":"proteintech-25188-1-ap","title":"Proteintech, 25188-1-AP, PFN3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PFN3 (25188-1-AP) by Proteintech is a Polyclonal antibody targeting PFN3 in WB, ELISA applications with reactivity to human, mouse, rat samples\n25188-1-AP targets PFN3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPFN3 also known as profilin-3, belongs to the profilin family, a family of actin-binding proteins that regulate the dynamics of actin in cells. PFN3 may be involved in spermatogenesis. (PMID: 11867228). Deletion or abnormal function of PFN3 may lead to male infertility, especially in disorders associated with abnormal sperm acrosome development (spherozoospermia)(PMID: 34869336).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18131 Product name: Recombinant human PFN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC132952 Sequence: MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRHTFLQAGLSVGGRRCCVIRDHLLAEGDGVLDARTKGLDARAVCVGRAPRALLVLMGRRGVHGGILNKTVHELIRGLRMQGA Predict reactive species\nFull Name: profilin 3\nCalculated Molecular Weight: 137 aa, 15 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC132952\nGene Symbol: PFN3\nGene ID (NCBI): 345456\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P60673\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887757676713,"sku":"25188-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25188-1-ap","provider":"Iright","version":"1.0","type":"link"}