{"product_id":"proteintech-25200-1-ap","title":"Proteintech, 25200-1-AP, ZIM3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZIM3 (25200-1-AP) by Proteintech is a Polyclonal antibody targeting ZIM3 in WB, ELISA applications with reactivity to human samples\n25200-1-AP targets ZIM3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells,  A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZIM3 (Zinc Finger Imprinted 3), also known as ZNF657 or ZNF264, is a protein containing zinc finger and KRAB domains. It belongs to the Krüppel C2H2-type zinc finger protein family and comprises 11 C2H2-type zinc fingers and 1 KRAB domain. ZIM3 influences chromatin organization by binding to the KAP1 protein, thereby regulating gene transcription. ZIM3 is predicted to have DNA-binding transcription factor activity and is involved in the transcriptional regulation of RNA polymerase II. Additionally, ZIM3 plays a core regulatory role in human major zygotic genome activation (ZGA).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18411 Product name: Recombinant human ZIM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 56-327 aa of BC114503 Sequence: DVILRLEQGKEPWLEEEEVLGSGRAEKNGDIGGQIWKPKDVKESLAREVPSINKETLTTQKGVECDGSKKILPLGIDDVSSLQHYVQNNSHDDNGYRKLVGNNPSKFVGQQLKCNACRKLFSSKSRLQSHLRRHACQKPFECHSCGRAFGEKWKLDKHQKTHAEERPYKCENCGNAYKQKSNLFQHQKMHTKEKPYQCKTCGKAFSWKSSCINHEKIHNAKKSYQCNECEKSFRQNSTLIQHKKVHTGQKPFQCTDCGKAFIYKSDLVKHQR Predict reactive species\nFull Name: zinc finger, imprinted 3\nCalculated Molecular Weight: 472 aa, 57 kDa\nObserved Molecular Weight: 55-65 kDa\nGenBank Accession Number: BC114503\nGene Symbol: ZIM3\nGene ID (NCBI): 114026\nRRID: AB_2879955\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96PE6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887936721065,"sku":"25200-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25200-1-ap","provider":"Iright","version":"1.0","type":"link"}