{"product_id":"proteintech-25204-1-ap","title":"Proteintech, 25204-1-AP, WIPI1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WIPI1 (25204-1-AP) by Proteintech is a Polyclonal antibody targeting WIPI1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n25204-1-AP targets WIPI1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SW 1990 cells,  HEK-293 cells,  NIH\/3T3 cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWIPI1, or WD repeat domain, phosphoinositide-interacting protein 1, is a member of the WD40 repeat family of proteins, which are key components of many essential biological functions. WIPI1 is involved in the regulation of autophagy, a cellular process critical for maintaining cellular integrity and recycling intracellular proteins, lipids, and organelles. WIPI1 is characterized by its 7-bladed β-propeller structure and contains a conserved motif for interaction with phospholipids, specifically binding to phosphoinositides. This interaction is crucial for its function in autophagy, where it acts as an effector of phosphatidylinositol 3-phosphate (PtdIns3P). WIPI1 and WIPI2 are among the first proteins to be recruited during autophagy, with WIPI2 interacting with components of the ULK1\/2 complex and PtdIns3P, tethering the phagophore to the endoplasmic reticulum (ER). WIPI1 supports the function of WIPI2 in recruiting the ATG16L complex, which is essential for LC3 lipidation and autophagosome formation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18461 Product name: Recombinant human WIPI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 346-446 aa of BC039867 Sequence: QDGGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRGNQKGKTKQS Predict reactive species\nFull Name: WD repeat domain, phosphoinositide interacting 1\nCalculated Molecular Weight: 446 aa, 49 kDa\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: BC039867\nGene Symbol: WIPI1\nGene ID (NCBI): 55062\nRRID: AB_2879958\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5MNZ9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869627830441,"sku":"25204-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25204-1-ap","provider":"Iright","version":"1.0","type":"link"}