{"product_id":"proteintech-25218-1-ap","title":"Proteintech, 25218-1-AP, USE1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe USE1 (25218-1-AP) by Proteintech is a Polyclonal antibody targeting USE1 in WB, IHC, ELISA applications with reactivity to human samples\n25218-1-AP targets USE1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  Jurkat cells\nPositive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUSE1(Vesicle transport protein USE1) is also named as USE1L, p31 and belongs to the USE1 family. It may be an essential molecule involved in the maintenance of ER morphology (and its deficiency leads to ER stress-induced apoptosis). USE1 also participates in the degradative function of lysosomes. This protein has 3 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18587 Product name: Recombinant human USE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-231 aa of BC008455 Sequence: MAASRLELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASEVINEYSWKVDFLKGMLQAEKLTSSSEKALANQFLAPGRVPTTARERVPATKTVHLQSRARYTSEMRSELLGTDSAEPEMDVRKRTGVAGSQPVSEKQSAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKSVN Predict reactive species\nFull Name: unconventional SNARE in the ER 1 homolog (S. cerevisiae)\nCalculated Molecular Weight: 259 aa, 29 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC008455\nGene Symbol: USE1\nGene ID (NCBI): 55850\nRRID: AB_2879966\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NZ43\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869507506345,"sku":"25218-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25218-1-ap","provider":"Iright","version":"1.0","type":"link"}