{"product_id":"proteintech-25219-1-ap","title":"Proteintech, 25219-1-AP, DACH2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DACH2 (25219-1-AP) by Proteintech is a Polyclonal antibody targeting DACH2 in WB, ELISA applications with reactivity to human,  mouse samples\n25219-1-AP targets DACH2 in WB, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue,  HeLa cells,  mouse eye tissue,  mouse kidney tissue,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDachshund homolog 2 (DACH2), is a 599 amino acid protein, which belongs to the DACH family. DACH2 localizes in the nucleus and as a transcription factor is involved in regulation of organogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18403 Product name: Recombinant human DACH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-181 aa of BC114950 Sequence: KRSLGVLQENARLLTHAVPGLLSPGLITPTGITAAAMAEAMKLQKMKLMAMNTLQGNGSQNGTESEPDDLNSNTGGSESSWDKDKMQSPFAAPGPQHGIAHAALAGQPGIGGAPTLNPLQQNHLLTNRLDLP Predict reactive species\nFull Name: dachshund homolog 2 (Drosophila)\nCalculated Molecular Weight: 599 aa, 65 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC114950\nGene Symbol: DACH2\nGene ID (NCBI): 117154\nRRID: AB_2879967\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96NX9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887057195177,"sku":"25219-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25219-1-ap","provider":"Iright","version":"1.0","type":"link"}