{"product_id":"proteintech-25222-1-ap","title":"Proteintech, 25222-1-AP, DTX4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DTX4 (25222-1-AP) by Proteintech is a Polyclonal antibody targeting DTX4 in WB, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse samples\n25222-1-AP targets DTX4 in WB, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue\nPositive IF-P detected in: mouse embryo tissue\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDTX4, also named as KIAA0937, RNF155, is a 619 amino acid protein, which belongs to the Deltex family. DTX4 as a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. DTX4 functions as a ubiquitin ligase protein in vivo, mediating 'Lys48'-linked polyubiquitination and promoting degradation of TBK1, targeting to TBK1 requires interaction with NLRP4.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18415 Product name: Recombinant human DTX4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 51-213 aa of BC119011 Sequence: LDLIYPMVTGTLPKAQSWPVSPGPATSPPMSPCSCPQCVLVMSVKAAVVNGSTGPLQLPVTRKNMPPPGVVKLPPLPGSGAKPLDSTGTIRGPLKTAPSQVIRRQASSMPTGTTMGSPASPPGPNSKTGRVALATLNRTNLQRLAIAQSRVLIASGVPTVPVK Predict reactive species\nFull Name: deltex homolog 4 (Drosophila)\nCalculated Molecular Weight: 619 aa, 67 kDa\nObserved Molecular Weight: 67-70 kDa\nGenBank Accession Number: BC119011\nGene Symbol: DTX4\nGene ID (NCBI): 23220\nRRID: AB_2879970\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2E6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869403762857,"sku":"25222-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25222-1-ap","provider":"Iright","version":"1.0","type":"link"}