{"product_id":"proteintech-25223-1-ap","title":"Proteintech, 25223-1-AP, UCP5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UCP5 (25223-1-AP) by Proteintech is a Polyclonal antibody targeting UCP5 in WB, ELISA applications with reactivity to human samples\n25223-1-AP targets UCP5 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue,  PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUCP5, also known as BMCP1 (brain mitochondrial carrier protein-1), is a member of uncoupling proteins (UCPs) that catalyze proton leaks across the inner mitochondrial membrane, thus uncoupling fuel oxidation from ATP synthesis. UCPs are implicated in metabolic rate and adaptational thermoregulation. UCP5 is widely expressed with high abundance in brain and testis. Alternative splicing generates several isoforms of UCP5.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18661 Product name: Recombinant human SLC25A14 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2-111 aa of BC119666 Sequence: GIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPAL Predict reactive species\nFull Name: solute carrier family 25 (mitochondrial carrier, brain), member 14\nCalculated Molecular Weight: 325 aa, 36 kDa\nObserved Molecular Weight: 36-40 kDa\nGenBank Accession Number: BC119666\nGene Symbol: UCP5\nGene ID (NCBI): 9016\nRRID: AB_2879971\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95258\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887916404905,"sku":"25223-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25223-1-ap","provider":"Iright","version":"1.0","type":"link"}