{"product_id":"proteintech-25245-1-ap","title":"Proteintech, 25245-1-AP, SLC10A2\/ASBT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC10A2\/ASBT (25245-1-AP) by Proteintech is a Polyclonal antibody targeting SLC10A2\/ASBT in WB, IP, ELISA applications with reactivity to human, mouse samples\n25245-1-AP targets SLC10A2\/ASBT in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse small intestine tissue\nPositive IP detected in: mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC10A2 also known as ASBT, ISBT, and NTCP2, is a sodium\/bile acid cotransporter that is primarily responsible for the uptake of bile acids by apical cells in the distal ileum(PMID: 8661017). Mutations in SLC10A2 cause primary bile acid malabsorption (PBAM) and may be associated with other diseases of the liver and intestines, such as familial hypertriglyceridemia (FHTG)(PMID: 9109432).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, hamster\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18808 Product name: Recombinant human SLC10A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 292-348 aa of BC130523 Sequence: IYSIFQLAFAAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK Predict reactive species\nFull Name: solute carrier family 10 (sodium\/bile acid cotransporter family), member 2\nCalculated Molecular Weight: 348 aa, 38 kDa\nObserved Molecular Weight: 38-40 kDa\nGenBank Accession Number: BC130523\nGene Symbol: ASBT\nGene ID (NCBI): 6555\nRRID: AB_2879986\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q12908\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868880523433,"sku":"25245-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25245-1-ap","provider":"Iright","version":"1.0","type":"link"}