{"product_id":"proteintech-25252-1-ap","title":"Proteintech, 25252-1-AP, GUCY2F Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GUCY2F (25252-1-AP) by Proteintech is a Polyclonal antibody targeting GUCY2F in WB, IHC, ELISA applications with reactivity to human,   mouse samples\n25252-1-AP targets GUCY2F in WB, IHC, IF, ELISA applications and shows reactivity with human,   mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGUCY2F(Guanylate cyclase 2F, retinal) is also named as GUC2F, RETGC2 and belongs to the adenylyl cyclase class-4\/guanylyl cyclase family. GUCY2F may play a specific functional role in the rods and\/or cones of photoreceptors. It may be the enzyme involved in the resynthesis of cGMP required for recovery of the dark state after phototransduction. By in situ hybridization, mRNA encoding GUCY2F is found only in the outer nuclear layer and inner segments of photoreceptor cells. By using synthetic peptide antiserum specific for each RetGC subtype, RetGC-2(GUCY2F) can be distinguished from RetGC-1 as a slightly smaller protein in immunoblots of bovine rod outer segments.(PMID:7777544).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19266 Product name: Recombinant human GUCY2F protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 71-398 aa of BC156674 Sequence: LPEVAARLAIERINRDPSFDLSYSFEYVILNEDCQTSRALSSFISHHQMASGFIGPTNPGYCEAASLLGNSWDKGIFSWACVNYELDNKISYPTFSRTLPSPIRVLVTVMKYFQWAHAGVISSDEDIWVHTANRVASALRSHGLPVGVVLTTGQDSQSMRKALQRIHQADRIRIIIMCMHSALIGGETQMHLLECAHDLKMTDGTYVFVPYDALLYSLPYKHTPYRVLRNNPKLREAYDAVLTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIAQAMNNAMKENGQAGAASLVQHSRNMQFHGFNQLMRTDS Predict reactive species\nFull Name: guanylate cyclase 2F, retinal\nCalculated Molecular Weight: 1108 aa, 125 kDa\nObserved Molecular Weight: 125 kDa\nGenBank Accession Number: BC156674\nGene Symbol: GUCY2F\nGene ID (NCBI): 2986\nRRID: AB_2879989\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P51841\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869547712681,"sku":"25252-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25252-1-ap","provider":"Iright","version":"1.0","type":"link"}