{"product_id":"proteintech-25256-1-ap","title":"Proteintech, 25256-1-AP, SFMBT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SFMBT2 (25256-1-AP) by Proteintech is a Polyclonal antibody targeting SFMBT2 in WB, ELISA applications with reactivity to mouse, rat samples\n25256-1-AP targets SFMBT2 in WB, CoIP, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, NIH\/3T3 cells,  mouse spleen tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSFMBT2 (Scm like with four mbt domains 2), also named as KIAA1617. It is located in Nucleus and ubiquitous expression in thyroid and ovary. The calculated molecular weight of SFMBT2 is 100 kDa. Although mammalian SFMBTs have similar structural features with PcG protein dSFMBT, biological function and target genes of SFMBT have been not investigated well. Lee K and Na W investigated biological function of human SFMBT2 that interacted with YY1 using AR (androgen receptor)-negative DU145 prostate cancer cells. They found that human SFMBT2 represses HOXB13 gene expression via its association with methylated histones H3 and H4 that are transcriptional repression marks. Furthermore, their findings indicate that SFMBT2 may be involved in regulation of cell growth of DU145 prostate cancer cells (PMID: 23385818).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19379 Product name: Recombinant human SFMBT2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 133-325 aa of BC152430 Sequence: WCTQNNKVLMPPDAIKEKYTDWTEFLIRDLTGSRTAPANLLEGPLRGKGPIDLITVGSLIELQDSQNPFQYWIVSVIENVGGRLRLRYVGLEDTESYDQWLFYLDYRLRPVGWCQENKYRMDPPSEIYPLKMASEWKCTLEKSLIDAAKFPLPMEVFKDHADLRSHFFTVGMKLETVNMCEPFYISPASVTKV Predict reactive species\nFull Name: Scm-like with four mbt domains 2\nCalculated Molecular Weight: 894 aa, 101 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC152430\nGene Symbol: SFMBT2\nGene ID (NCBI): 57713\nRRID: AB_2833000\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5VUG0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869429747881,"sku":"25256-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25256-1-ap","provider":"Iright","version":"1.0","type":"link"}