{"product_id":"proteintech-25259-1-ap","title":"Proteintech, 25259-1-AP, DUPD1 \/ DUSP27 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DUPD1 \/ DUSP27 (25259-1-AP) by Proteintech is a Polyclonal antibody targeting DUPD1 \/ DUSP27 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n25259-1-AP targets DUPD1 \/ DUSP27 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDupd1also named as Dusp27, has been categorized as an atypical dual-specificity phosphatase (Dusp) capable of dephosphorylating both tyrosine and serine\/threonine residues. It's involved in the modulation of intracellular signaling cascades. In skeletal muscle Dupd1 regulates systemic glucose homeostasis by activating AMPK, which is an energy sensor protein kinase. Dupd1 also affects MAP kinase signaling though modulation of the MAPK1\/2 cascade in skeletal muscle promoting muscle cell differentiation, development and atrophy.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19658 Product name: Recombinant human DUPD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-150 aa of BC137322 Sequence: MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDHSKILVHCVMG Predict reactive species\nFull Name: dual specificity phosphatase and pro isomerase domain containing 1\nCalculated Molecular Weight: 220 aa, 25 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC137322\nGene Symbol: DUSP27\nGene ID (NCBI): 338599\nRRID: AB_3085779\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q68J44\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869676982441,"sku":"25259-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25259-1-ap","provider":"Iright","version":"1.0","type":"link"}