{"product_id":"proteintech-25281-1-ap","title":"Proteintech, 25281-1-AP, BEX5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BEX5 (25281-1-AP) by Proteintech is a Polyclonal antibody targeting BEX5 in IHC, ELISA applications with reactivity to human, mouse samples\n25281-1-AP targets BEX5 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Brain-Expressed X-linked (BEX) family proteins are comprised of five human proteins including BEX1, BEX2, BEX3, BEX4, and BEX5. While human BEX5 is widely expressed in many tissues, BEX5 has not been studied well (PMID: 26408910).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16446 Product name: Recombinant human BEX5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC106955 Sequence: MENVPKENKVVEKAPVQNEAPALGGGEYQEPGGNVKGVWAPPAPGFGEDVPNRLVDNIDMIDGDG Predict reactive species\nFull Name: brain expressed, X-linked 5\nCalculated Molecular Weight: 111 aa, 13 kDa\nGenBank Accession Number: BC106955\nGene Symbol: BEX5\nGene ID (NCBI): 340542\nRRID: AB_3085780\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5H9J7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885232017577,"sku":"25281-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25281-1-ap","provider":"Iright","version":"1.0","type":"link"}