{"product_id":"proteintech-25306-1-ap","title":"Proteintech, 25306-1-AP, F2RL3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe F2RL3 (25306-1-AP) by Proteintech is a Polyclonal antibody targeting F2RL3 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n25306-1-AP targets F2RL3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, mouse pancreas tissue\nPositive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCoagulation factor II receptor-like 3 (F2RL3) encodes a member of the protease-activated receptor subfamily, also known as protease-activated receptor 4  (PAR4), which takes partin platelet activation, intimal hyperplasia and inflammation (PMID:34284820). An absence of PAR4 in mouse models results in impaired hemostasis and a protection against pulmonary embolism, and a small number of missense coding variants in F2RL3 that alter platelet aggregation and function have been described(PMID:35012325). The calculated molecular weight and observed molecular weight of F2RL3 are both 41 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20801 Product name: Recombinant human F2RL3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 305-385 aa of BC074782 Sequence: LHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ Predict reactive species\nFull Name: coagulation factor II (thrombin) receptor-like 3\nCalculated Molecular Weight: 385 aa, 41 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC074782\nGene Symbol: F2RL3\nGene ID (NCBI): 9002\nRRID: AB_2880022\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96RI0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869405532329,"sku":"25306-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25306-1-ap","provider":"Iright","version":"1.0","type":"link"}