{"product_id":"proteintech-25318-1-ap","title":"Proteintech, 25318-1-AP, Desmoplakin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Desmoplakin (25318-1-AP) by Proteintech is a Polyclonal antibody targeting Desmoplakin in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n25318-1-AP targets Desmoplakin in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HepG2 cells,  mouse heart tissue,  BxPC-3 cells,  HEK-293 cells\nPositive IP detected in: BxPC-3 cells\nPositive IHC detected in: rat heart tissue, human normal colon,  human bowen disease,  mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:2500-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:750-1:3000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe desmoplakin (DP) is the most abundant desmosomal proteins and is located at the cytoplasmic portion of the desmosomes which are specialized cell-cell adhesion structures abundant in tissues such as muscle and epidermis that are subjected to mechanical stress. Desmoplakin 1 and 2 (DP 1 and 2) are two splice variants sharing common C-terminal and N-terminal globular head and tail domains, but differ in the length of the rod domain that links them. This antibody detects both DP1 (280-330 kDa) and DP2 (240-260 kDa). (PMID: 16467215, 11781569)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18065 Product name: Recombinant human DSP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC140802 Sequence: MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAY Predict reactive species\nFull Name: desmoplakin\nCalculated Molecular Weight: 2871 aa, 332 kDa\nObserved Molecular Weight: 240-330 kDa\nGenBank Accession Number: BC140802\nGene Symbol: DSP\nGene ID (NCBI): 1832\nRRID: AB_2880028\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P15924\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868878753961,"sku":"25318-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25318-1-ap","provider":"Iright","version":"1.0","type":"link"}