{"product_id":"proteintech-25322-1-ap","title":"Proteintech, 25322-1-AP, GNAT3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNAT3 (25322-1-AP) by Proteintech is a Polyclonal antibody targeting GNAT3 in IHC, ELISA applications with reactivity to human, mouse samples\n25322-1-AP targets GNAT3 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGNAT3 (Guanine nucleotide-binding protein G(t) subunit alpha-3), also known as α-gustducin, is a protein that plays a key role in taste signaling. It is part of the G-protein family and is mainly expressed in Type II taste cells in the taste buds of the tongue. GNAT3 is involved in detecting sweet, bitter, and umami tastes by activating a signaling cascade that includes PLCβ2, TRPM5, and other downstream effectors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18121 Product name: Recombinant human GNAT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 83-137 aa of BC147016 Sequence: AIVKAMTTLGIDYVNPRSAEDQRQLYAMANTLEDGGMTPQLAEVIKRLWRDPGIQ Predict reactive species\nFull Name: guanine nucleotide binding protein, alpha transducing 3\nCalculated Molecular Weight: 354 aa, 40 kDa\nGenBank Accession Number: BC147016\nGene Symbol: GNAT3\nGene ID (NCBI): 346562\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: A8MTJ3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887653605545,"sku":"25322-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25322-1-ap","provider":"Iright","version":"1.0","type":"link"}