{"product_id":"proteintech-25373-1-ap","title":"Proteintech, 25373-1-AP, Exportin 4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Exportin 4 (25373-1-AP) by Proteintech is a Polyclonal antibody targeting Exportin 4 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n25373-1-AP targets Exportin 4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HL-60 cells,  HeLa cells,  RAW 264.7 cells\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nexportin 4 (XPO4) maps to chromosome 13q and belongs to the importin β family which acts as a bidirectional nuclear transport receptor.  Decreased XPO4 expression has been shown to associate with hepatocellular carcinoma.  A genome-wide copy number variation (CNV) association study in a small cohort of Malaysian subjects identified a CNV in XPO4 to be correlated with the progression of metabolic (dysfunction) associated fatty liver disease (MAFLD). (PMID: 34388518)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21845 Product name: Recombinant human XPO4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 776-1124 aa of BC113571 Sequence: QEITATLEALCGIAEATQIDNVAILFNFLMDFLTNCIGLMEVYKNTPETVNLIIEVFVEVAHKQICYLGESKAMNLYEACLTLLQVYSKNNLGRQRIDVTAEEEQYQDLLLIMELLTNLLSKEFIDFSDTDEVFRGHEPGQAANRSVSAADVVLYGVNLILPLMSQDLLKFPTLCNQYYKLITFICEIFPEKIPQLPEDLFKSLMYSLELGMTSMSSEVCQLCLEALTPLAEQCAKAQETDSPLFLATRHFLKLVFDMLVLQKHNTEMTTAAGEAFYTLVCLHQAEYSELVETLLSSQQDPVIYQRLADAFNKLTASSTPPTLDRKQKMAFLKSLEEFMANVGGLLCVK Predict reactive species\nFull Name: exportin 4\nCalculated Molecular Weight: 1151 aa, 130 kDa\nObserved Molecular Weight: 127 kDa\nGenBank Accession Number: BC113571\nGene Symbol: Exportin 4\/XPO4\nGene ID (NCBI): 64328\nRRID: AB_3085791\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9C0E2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869680455849,"sku":"25373-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25373-1-ap","provider":"Iright","version":"1.0","type":"link"}