{"product_id":"proteintech-25377-1-ap","title":"Proteintech, 25377-1-AP, DDI2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDI2 (25377-1-AP) by Proteintech is a Polyclonal antibody targeting DDI2 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n25377-1-AP targets DDI2 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HL-60 tissue,  HUVEC tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDDI2 contains 399 amino acids and contains an N-terminal ubiquitin-like (UBL) domain and a highly conserved retroviral protease-like (RVP) domain. DDI2 is an aspartic endoprotease that cleaves ubiquitylated target proteins to assist in their processing by the ubiquitin-proteasome system (UPS), especially when the UPS is inhibited(PMID: 32521225).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21953 Product name: Recombinant human DDI2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 22-62 aa of BC006011 Sequence: DADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLA Predict reactive species\nFull Name: DDI1, DNA-damage inducible 1, homolog 2 (S. cerevisiae)\nCalculated Molecular Weight: 399 aa, 45 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC006011\nGene Symbol: DDI2\nGene ID (NCBI): 84301\nRRID: AB_3669472\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5TDH0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887104512169,"sku":"25377-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25377-1-ap","provider":"Iright","version":"1.0","type":"link"}