{"product_id":"proteintech-25410-1-ap","title":"Proteintech, 25410-1-AP, TTDN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TTDN1 (25410-1-AP) by Proteintech is a Polyclonal antibody targeting TTDN1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n25410-1-AP targets TTDN1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTTDN1 colocalizes with Plk1 at the centrosome in mitosis and the midbody during cytokinesis. It is phosphorylated by Cdk1 in mitosis, and this is required for its interaction with Plk1. Overexpression of TTDN1 or its knockdown by siRNA causes multi-polar spindles and multiple nuclei, suggesting that TTDN1 plays a role in regulating mitosis and cytokinesis. Mutations in the TTDN1 gene are associated with a distinct trichothiodystrophy phenotype. (PMID:17310276, 25290684)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22094 Product name: Recombinant human C7orf11 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-179 aa of BC026265 Sequence: MQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRPYGSSHSPRHGGSFPGGRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFC Predict reactive species\nFull Name: chromosome 7 open reading frame 11\nCalculated Molecular Weight: 179 aa, 19 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC026265\nGene Symbol: TTDN1\nGene ID (NCBI): 136647\nRRID: AB_2935461\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TAP9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887910801577,"sku":"25410-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25410-1-ap","provider":"Iright","version":"1.0","type":"link"}