{"product_id":"proteintech-25418-1-ap","title":"Proteintech, 25418-1-AP, TSC22D2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TSC22D2 (25418-1-AP) by Proteintech is a Polyclonal antibody targeting TSC22D2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n25418-1-AP targets TSC22D2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, MDA-MB-453s cells,  HepG2 cells,  SH-SY5Y cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human kidney tissue,  human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTSC22D2 (transforming growth factor β-stimulated clone 22 domain family, member 2) is a member of the TSC-22 domain family comprising putative transcription factors that are characterized by a carboxy-terminal leucine zipper and an adjacent TSC-box. TSC22D2 is expressed at low levels in CRC and that TSC22D2 overexpression significantly inhibited the growth rate of cancer cells (PMID: 27573352).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22294 Product name: Recombinant human TSC22D2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 190-543 aa of BC044643 Sequence: SDSSVLTRSGDCIRHSSTFDQTAERDSGLGATGGSVVVVVASMQGAHGPESGTDSSLTAVSQLPPSEKMSQPTPAQPQSFSVGQPQPPPPPVGGAVAQSSAPLPPFPGAATGPQPMMAAAQPSQPQGAGPGGQTLPPTNVTLAQPAMSLPPQPGPAVGAPAAQQPQQFAYPQPQIPPGHLLPVQPSGQSEYLQQHVAGLQPPSPAQPSSTGAAASPATAATLPVGTGQNASSVGAQLMGASSQPSEAMAPRTGPAQGGQVAPCQPTGVPPATVGGVVQPCLGPAGAGQPQSVPPPQMGGSGPLSAVPGGPHAVVPGVPNVPAAVPAPSVPSVSTTSVTMPNVPAPLAQSQQLSS Predict reactive species\nFull Name: TSC22 domain family, member 2\nCalculated Molecular Weight: 780 aa, 79 kDa\nObserved Molecular Weight: 100-110 kDa\nGenBank Accession Number: BC044643\nGene Symbol: TSC22D2\nGene ID (NCBI): 9819\nRRID: AB_2880069\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75157\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869782003881,"sku":"25418-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25418-1-ap","provider":"Iright","version":"1.0","type":"link"}