{"product_id":"proteintech-25422-1-ap","title":"Proteintech, 25422-1-AP, TTC32 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TTC32 (25422-1-AP) by Proteintech is a Polyclonal antibody targeting TTC32 in WB, IP, IHC, ELISA applications with reactivity to human,  mouse samples\n25422-1-AP targets TTC32 in WB, IP, IHC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22115 Product name: Recombinant human TTC32 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-151 aa of BC057850 Sequence: MEGQRQESHATLTLAQAHFNNGEYAEAEALYSAYIRRCACAASSDESPGSKCSPEDLATAYNNRGQIKYFRVDFYEAMDDYTSAIEVQPNFEVPYYNRGLILYRLGYFDDALEDFKKVLDLNPGFQDATLSLKQTILDKEEKQRRNVAKNY Predict reactive species\nFull Name: tetratricopeptide repeat domain 32\nCalculated Molecular Weight: 151 aa, 17 kDa\nObserved Molecular Weight: 17-30 kDa\nGenBank Accession Number: BC057850\nGene Symbol: TTC32\nGene ID (NCBI): 130502\nRRID: AB_2880073\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5I0X7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887910310057,"sku":"25422-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25422-1-ap","provider":"Iright","version":"1.0","type":"link"}