{"product_id":"proteintech-25424-1-ap","title":"Proteintech, 25424-1-AP, PLEKHF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLEKHF2 (25424-1-AP) by Proteintech is a Polyclonal antibody targeting PLEKHF2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n25424-1-AP targets PLEKHF2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: rat brown adipose tissue, mouse brown adipose tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brown adipose tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPhafin2 is a lysosomal protein consisting of 249 amino acids with a unique structure containing\nboth an N-terminal PH (pleckstrin homology) domain and C terminal FYVE (Fab 1, YOTB, Vac 1, and EEA1) domain.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22285 Product name: Recombinant human PLEKHF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 186-249 aa of BC011806 Sequence: CSEKRFLLPSQSSKPVRICDFCYDLLSAGDMATCQPARSDSYSQSLKSPLNDMSDDDDDDDSSD Predict reactive species\nFull Name: pleckstrin homology domain containing, family F (with FYVE domain) member 2\nCalculated Molecular Weight: 249 aa, 28 kDa\nObserved Molecular Weight: 22-27 kDa\nGenBank Accession Number: BC011806\nGene Symbol: PLEKHF2\nGene ID (NCBI): 79666\nRRID: AB_3669474\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H8W4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887765835945,"sku":"25424-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25424-1-ap","provider":"Iright","version":"1.0","type":"link"}