{"product_id":"proteintech-25434-1-ap","title":"Proteintech, 25434-1-AP, KREMEN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KREMEN1 (25434-1-AP) by Proteintech is a Polyclonal antibody targeting KREMEN1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n25434-1-AP targets KREMEN1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKringle containing transmembrane protein 1 (KREMEN1, also known as KRM1, ECTD13, and KREMEN) is a transmembrane receptor located in the membrane. During the development of various organs, including the nervous system, limbs, and liver, KREMEN1 synergizes with the Dkk proteins to inhibit Wnt signaling (PMID: 18505822). KREMEN1 has been reported as a tumor suppressor, preventing cancer cell survival in a ligand-poor environment (PMID: 31069116). Variations and mutations of KREMEN1 have been associated with ectodermal dysplasia and Hand-foot-and-mouth disease (PMID: 34028942; 31911601).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22092 Product name: Recombinant human KREMEN1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 234-458 aa of BC063787 Sequence: DTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGWTVYGLATLLILTVTAIVAKILLHVTFKSHRVPASGDLRDCHQPGTSGEIWSIFYKPSTSISIFKKKLKGQSQQDDRNPLVSD Predict reactive species\nFull Name: kringle containing transmembrane protein 1\nCalculated Molecular Weight: 473 aa, 52 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC063787\nGene Symbol: KREMEN1\nGene ID (NCBI): 83999\nRRID: AB_3669475\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96MU8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887699611817,"sku":"25434-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25434-1-ap","provider":"Iright","version":"1.0","type":"link"}