{"product_id":"proteintech-25450-1-ap","title":"Proteintech, 25450-1-AP, DCLK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DCLK2 (25450-1-AP) by Proteintech is a Polyclonal antibody targeting DCLK2 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n25450-1-AP targets DCLK2 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDCLK2 belongs to the protein kinase superfamily, contains two N-terminal doublecortin domains, a C-terminal serine\/threonine protein kinase domain, and a serine\/proline-rich domain in between the doublecortin and the protein kinase domains. DCLK2 is expressed in the brain, heart and eyes (PMID: 18075264).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22142 Product name: Recombinant human DCLK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-71 aa of BC032726 Sequence: MLQVNVEARCTAGQILSHPWVSDDASQENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMFDLTV Predict reactive species\nFull Name: doublecortin-like kinase 2\nCalculated Molecular Weight: 766 aa, 84 kDa\nObserved Molecular Weight: 83 kDa\nGenBank Accession Number: BC032726\nGene Symbol: DCLK2\nGene ID (NCBI): 166614\nRRID: AB_3085796\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N568\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887085146281,"sku":"25450-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25450-1-ap","provider":"Iright","version":"1.0","type":"link"}