{"product_id":"proteintech-25503-1-ap","title":"Proteintech, 25503-1-AP, UCMA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UCMA (25503-1-AP) by Proteintech is a Polyclonal antibody targeting UCMA in WB, ELISA applications with reactivity to human, mouse samples\n25503-1-AP targets UCMA in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUCMA, also named as C10orf49, Ucma-C and GRP, is a 17 kDa small, highly charged, and secreted protein. It has been described as a novel secretory protein mainly expressed in cartilage and also as a novel vitamin-K-dependent protein. UCMA is involved in the negative control of osteogenic differentiation of osteochondrogenic precursor cells in peripheral zones of fetal cartilage and at the cartilage-bone interface.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21985 Product name: Recombinant human UCMA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-139 aa of BC018068 Sequence: VSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGKRSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT Predict reactive species\nFull Name: upper zone of growth plate and cartilage matrix associated\nCalculated Molecular Weight: 138 aa, 17 kDa\nObserved Molecular Weight: ~14 kDa\nGenBank Accession Number: BC018068\nGene Symbol: UCMA\nGene ID (NCBI): 221044\nRRID: AB_2880106\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WVF2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887916208297,"sku":"25503-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25503-1-ap","provider":"Iright","version":"1.0","type":"link"}