{"product_id":"proteintech-25536-1-ap","title":"Proteintech, 25536-1-AP, TMEM115 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM115 (25536-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM115 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n25536-1-AP targets TMEM115 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, mouse skeletal muscle tissue,  rat skeletal muscle tissue\nPositive IHC detected in: human ovary cancer tissue, human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM115 also known as PL6, located on chromosome 3p21.3, was originally thought to function as a tumor suppressor. TMEM115 is an integral membrane protein of the Golgi complex involved in retrograde transport.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22258 Product name: Recombinant human TMEM115 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 233-351 aa of BC017367 Sequence: QPVVGLLANLVHSLLVKVKICQKTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITFEAAPPTL Predict reactive species\nFull Name: transmembrane protein 115\nCalculated Molecular Weight: 351 aa, 38 kDa\nObserved Molecular Weight: 35-38 kDa\nGenBank Accession Number: BC017367\nGene Symbol: TMEM115\nGene ID (NCBI): 11070\nRRID: AB_3669482\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q12893\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887830061225,"sku":"25536-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25536-1-ap","provider":"Iright","version":"1.0","type":"link"}