{"product_id":"proteintech-25538-1-ap","title":"Proteintech, 25538-1-AP, MPP4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MPP4 (25538-1-AP) by Proteintech is a Polyclonal antibody targeting MPP4 in WB, ELISA applications with reactivity to human, mouse samples\n25538-1-AP targets MPP4 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse retina tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMPP4 (Membrane protein palmitoylated 4), also named as DLG6, belongs to the MAGUK family  which interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions. MPP4 is a retina-specific scaffolding protein hat plays an important role in signal transmission at the photoreceptor synapse (PMID: 18955048).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22235 Product name: Recombinant human MPP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-131 aa of BC132785 Sequence: MIQSDKGADPPDKKDMKLSTATNPQNGLSQILRLVLQELSLFYSRDVNGVCLLYDLLHSPWLQALLKIYDCLQEFKEKKLVPATPHAQVLSYEVVELLRETPTSPEIQELRQMLQAPHFKALLSAHDTIAQ Predict reactive species\nFull Name: membrane protein, palmitoylated 4 (MAGUK p55 subfamily member 4)\nCalculated Molecular Weight: 630 aa, 72 kDa\nObserved Molecular Weight: 73 kDa\nGenBank Accession Number: BC132785\nGene Symbol: MPP4\nGene ID (NCBI): 58538\nRRID: AB_3085803\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96JB8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887723434153,"sku":"25538-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25538-1-ap","provider":"Iright","version":"1.0","type":"link"}