{"product_id":"proteintech-25541-1-ap","title":"Proteintech, 25541-1-AP, SEC14L1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SEC14L1 (25541-1-AP) by Proteintech is a Polyclonal antibody targeting SEC14L1 in WB, IF\/ICC, IP, ELISA applications with reactivity to human samples\n25541-1-AP targets SEC14L1 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Y79 cells,  HeLa cells\nPositive IP detected in: HEK-293 cells\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSEC14L1 (SEC14-like protein 1) is a member of SEC14 family in mammals with the potential to control local phospholipid content in membranes. SEC14L1 may act as a phospholipid transfer protein. It has also been reported that SEC14L1 functions as a novel negative regulator of RIG-I-mediated antiviral signaling and is involved in innate immunity (PMID: 17092608; 23843640). SEC14L1 has three isoforms with the molecular mass of 81.2kDa, 81.8kDa and 77.1kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22233 Product name: Recombinant human SEC14L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 149-233 aa of BC142979 Sequence: MKQYTSNIKKGKEIIEYYLRQLEEEGITFVPRWSPPSITPSSETSSSSSKKQAASMAVVIPEAALKEGLSGDALSSPSAPEPVVG Predict reactive species\nFull Name: SEC14-like 1 (S. cerevisiae)\nCalculated Molecular Weight: 719 aa, 82 kDa\nObserved Molecular Weight: 81 kDa, 77 kDa\nGenBank Accession Number: BC142979\nGene Symbol: SEC14L1\nGene ID (NCBI): 6397\nRRID: AB_2880125\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92503\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869595029673,"sku":"25541-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-25541-1-ap","provider":"Iright","version":"1.0","type":"link"}